NUDT21 (NM_007006) Human Recombinant Protein

NUDT21 protein,

Product Info Summary

SKU: PROTO43809
Size: 20 µg
Source: HEK293T

Product Name

NUDT21 (NM_007006) Human Recombinant Protein

View all NUDT21 recombinant proteins

SKU/Catalog Number

PROTO43809

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 21 (NUDT21)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDT21 (NM_007006) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43809)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26 kDa

Amino Acid Sequence

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Validation Images & Assay Conditions

Gene/Protein Information For NUDT21 (Source: Uniprot.org, NCBI)

Gene Name

NUDT21

Full Name

Cleavage and polyadenylation specificity factor subunit 5

Weight

26 kDa

Superfamily

Nudix hydrolase family

Alternative Names

CFIm25; CFIM25CPSF 25 kDa subunit; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specific factor 5, 25 kDa; Cleavage and polyadenylation specificity factor 25 kDa subunit; cleavage and polyadenylation specificity factor subunit 5; CPSF25; CPSF5DKFZp686H1588; Nucleoside diphosphate-linked moiety X motif 21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; Nudix motif 21; pre-mRNA cleavage factor Im (25kD); Pre-mRNA cleavage factor Im 25 kDa subunit; pre-mRNA cleavage factor Im, 25kD subunit NUDT21 CFIM25, CPSF5 nudix hydrolase 21 cleavage and polyadenylation specificity factor subunit 5|CPSF 25 kDa subunit|cleavage and polyadenylation specific factor 5, 25 kD subunit|cleavage and polyadenylation specific factor 5, 25 kDa|cleavage and polyadenylation specificity factor 25 kDa subunit|cleavage factor Im complex 25 kDa subunit|nucleoside diphosphate-linked moiety X motif 21|nudix (nucleoside diphosphate linked moiety X)-type motif 21|nudix motif 21|pre-mRNA cleavage factor Im (25kD)|pre-mRNA cleavage factor Im 25 kDa subunit|pre-mRNA cleavage factor Im 68 kDa subunit|pre-mRNA cleavage factor Im, 25kD subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDT21, check out the NUDT21 Infographic

NUDT21 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDT21: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43809

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUDT21 (NM_007006) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDT21 (NM_007006) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDT21 (NM_007006) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43809
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.