NUDC (NM_006600) Human Recombinant Protein

NUDC protein,

Product Info Summary

SKU: PROTQ9Y266
Size: 20 µg
Source: HEK293T

Product Name

NUDC (NM_006600) Human Recombinant Protein

View all NUDC recombinant proteins

SKU/Catalog Number

PROTQ9Y266

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear distribution gene C homolog (A. nidulans) (NUDC)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDC (NM_006600) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y266)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.1 kDa

Amino Acid Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Validation Images & Assay Conditions

Gene/Protein Information For NUDC (Source: Uniprot.org, NCBI)

Gene Name

NUDC

Full Name

Nuclear migration protein nudC

Weight

38.1 kDa

Superfamily

nudC family

Alternative Names

HNUDC; MNUDC; NPD011; nuclear distribution gene C (A.nidulans) homolog; nuclear distribution gene C homolog (A. nidulans); Nuclear distribution protein C homolog; nuclear migration protein nudC; NudC NUDC HNUDC, MNUDC, NPD011 nuclear distribution C, dynein complex regulator nuclear migration protein nudC|nuclear distribution C homolog|nuclear distribution gene C homolog|nuclear distribution protein C homolog|nudC nuclear distribution protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDC, check out the NUDC Infographic

NUDC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y266

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUDC (NM_006600) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDC (NM_006600) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDC (NM_006600) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y266
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.