Product Info Summary
SKU: | PROTQ02297 |
---|---|
Size: | 10ug, 50ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
NRG1 Heregulin-B2 Human Recombinant Protein
View all NRG1 recombinant proteins
SKU/Catalog Number
PROTQ02297
Size
10ug, 50ug, 1mg
Description
Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Cite This Product
NRG1 Heregulin-B2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02297)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4.
Purity
Greater than 96.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Biological Activity
The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of greater than 2.0 × 104 IU/mg.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For NRG1 (Source: Uniprot.org, NCBI)
Gene Name
NRG1
Full Name
Pro-neuregulin-1, membrane-bound isoform
Weight
Superfamily
neuregulin family
Alternative Names
ARIA; GGF2; GGFglial growth factor; Heregulin-1; HGL; HGLneu differentiation factor; HRG; HRG1; HRG1-alpha; HRG1-beta 1; HRGAneuregulin 1 type IV beta 1a; MST131; MSTP131; NDFheregulin, alpha (45kD, ERBB2 p185-activator); neuregulin 1 type IV beta 3; neuregulin 1; Neuregulin1; Neuregulin-1; NRG1; pro-neuregulin-1, membrane-bound isoform; pro-NRG1; sensory and motor neuron derived factor; SMDF NRG1 ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF-IT2, SMDF, NRG1 neuregulin 1 pro-neuregulin-1, membrane-bound isoform|acetylcholine receptor-inducing activity|glial growth factor 2|heregulin, alpha (45kD, ERBB2 p185-activator)|neu differentiation factor|pro-NRG1|sensory and motor neuron derived factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NRG1, check out the NRG1 Infographic
![NRG1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NRG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For NRG1 Heregulin-B2 Human Recombinant Protein (PROTQ02297)
Hello CJ!
No publications found for PROTQ02297
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used NRG1 Heregulin-B2 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For NRG1 Heregulin-B2 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question