NRG1 Heregulin-B2 Human Recombinant Protein

NRG1 protein, Human

Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ02297
Size: 10ug, 50ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

NRG1 Heregulin-B2 Human Recombinant Protein

View all NRG1 recombinant proteins

SKU/Catalog Number

PROTQ02297

Size

10ug, 50ug, 1mg

Description

Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Cite This Product

NRG1 Heregulin-B2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02297)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4.

Purity

Greater than 96.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Biological Activity

The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of greater than 2.0 × 104 IU/mg.

Reconstitution

It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For NRG1 (Source: Uniprot.org, NCBI)

Gene Name

NRG1

Full Name

Pro-neuregulin-1, membrane-bound isoform

Weight

Superfamily

neuregulin family

Alternative Names

ARIA; GGF2; GGFglial growth factor; Heregulin-1; HGL; HGLneu differentiation factor; HRG; HRG1; HRG1-alpha; HRG1-beta 1; HRGAneuregulin 1 type IV beta 1a; MST131; MSTP131; NDFheregulin, alpha (45kD, ERBB2 p185-activator); neuregulin 1 type IV beta 3; neuregulin 1; Neuregulin1; Neuregulin-1; NRG1; pro-neuregulin-1, membrane-bound isoform; pro-NRG1; sensory and motor neuron derived factor; SMDF NRG1 ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF-IT2, SMDF, NRG1 neuregulin 1 pro-neuregulin-1, membrane-bound isoform|acetylcholine receptor-inducing activity|glial growth factor 2|heregulin, alpha (45kD, ERBB2 p185-activator)|neu differentiation factor|pro-NRG1|sensory and motor neuron derived factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NRG1, check out the NRG1 Infographic

NRG1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NRG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ02297

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NRG1 Heregulin-B2 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NRG1 Heregulin-B2 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NRG1 Heregulin-B2 Human Recombinant Protein

Size

Total: $250

SKU:PROTQ02297

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ02297
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.