Product Info Summary
SKU: | PROTQ02297 |
---|---|
Size: | 10ug, 50ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
NRG1 Heregulin-B2 Human Recombinant Protein
View all NRG1 recombinant proteins
SKU/Catalog Number
PROTQ02297
Size
10ug, 50ug, 1mg
Description
Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Cite This Product
NRG1 Heregulin-B2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02297)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4.
Purity
Greater than 96.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
70.392kDa
Reconstitution
It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Biological Activity
The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of greater than 2.0 × 104 IU/mg.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For NRG1 (Source: Uniprot.org, NCBI)
Gene Name
NRG1
Full Name
Pro-neuregulin-1, membrane-bound isoform
Weight
70.392kDa
Superfamily
neuregulin family
Alternative Names
Neuregulin-1; NRG1; GGF; HGL; HRGA; NDF; SMDF; HRG; ARIA; GGF2; HRG1 NRG1 ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF-IT2, SMDF, NRG1 neuregulin 1 pro-neuregulin-1, membrane-bound isoform|acetylcholine receptor-inducing activity|glial growth factor 2|heregulin, alpha (45kD, ERBB2 p185-activator)|neu differentiation factor|pro-NRG1|sensory and motor neuron derived factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NRG1, check out the NRG1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NRG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For NRG1 Heregulin-B2 Human Recombinant Protein (PROTQ02297)
Hello CJ!
No publications found for PROTQ02297
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used NRG1 Heregulin-B2 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For NRG1 Heregulin-B2 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question