NPDC1 (NM_015392) Human Recombinant Protein

NPDC-1 protein,

Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1)

Product Info Summary

SKU: PROTQ9NQX5
Size: 20 µg
Source: HEK293T

Product Name

NPDC1 (NM_015392) Human Recombinant Protein

View all NPDC-1 recombinant proteins

SKU/Catalog Number

PROTQ9NQX5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NPDC1 (NM_015392) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NQX5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.3 kDa

Amino Acid Sequence

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

Validation Images & Assay Conditions

Gene/Protein Information For NPDC1 (Source: Uniprot.org, NCBI)

Gene Name

NPDC1

Full Name

Neural proliferation differentiation and control protein 1

Weight

34.3 kDa

Superfamily

NPDC1/cab-1 family

Alternative Names

CAB-; CAB1; CAB-1; CAB1CAB; DKFZp586J0523; neural proliferation differentiation and control protein 1; neural proliferation, differentiation and control, 1; NPDC1; NPDC-1 Npdc1|AI314472, NPDC, NPDC-1|neural proliferation, differentiation and control 1|neural proliferation differentiation and control protein 1|neural proliferation differentiation control-1 protein|neural proliferation, differentiation and control gene 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NPDC1, check out the NPDC1 Infographic

NPDC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NPDC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NQX5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NPDC1 (NM_015392) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NPDC1 (NM_015392) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NPDC1 (NM_015392) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NQX5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.