NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

NOLA1 protein,

Recombinant protein of human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 2

Product Info Summary

SKU: PROTQ9NY12
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

View all NOLA1 recombinant proteins

SKU/Catalog Number

PROTQ9NY12

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NOLA1 (GAR1) (NM_032993) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NY12)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.2 kDa

Amino Acid Sequence

MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

Validation Images & Assay Conditions

Gene/Protein Information For GAR1 (Source: Uniprot.org, NCBI)

Gene Name

GAR1

Full Name

H/ACA ribonucleoprotein complex subunit 1

Weight

22.2 kDa

Superfamily

GAR1 family

Alternative Names

GAR1 ribonucleoprotein homolog (yeast); H/ACA ribonucleoprotein complex subunit 1; NOLA1member 1 (H/ACA small nucleolar RNPs); Nucleolar protein family A member 1; snoRNP protein GAR1 GAR1 NOLA1 GAR1 ribonucleoprotein H/ACA ribonucleoprotein complex subunit 1|GAR1 homolog, ribonucleoprotein|GAR1 ribonucleoprotein homolog|nucleolar protein family A member 1|nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs)|snoRNP protein GAR1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GAR1, check out the GAR1 Infographic

GAR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GAR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NY12

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NOLA1 (GAR1) (NM_032993) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NY12
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.