NM23A (NME1) (NM_000269) Human Recombinant Protein

NME1 protein,

Product Info Summary

SKU: PROTP15531
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NM23A (NME1) (NM_000269) Human Recombinant Protein

View all NME1 recombinant proteins

SKU/Catalog Number

PROTP15531

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NM23A (NME1) (NM_000269) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP15531)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17 kDa

Amino Acid Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Validation Images & Assay Conditions

Gene/Protein Information For NME1 (Source: Uniprot.org, NCBI)

Gene Name

NME1

Full Name

Nucleoside diphosphate kinase A

Weight

17 kDa

Superfamily

NDK family

Alternative Names

EC 2.7.4.6; GAAD; Granzyme A-activated DNase; Metastasis inhibition factor nm23; NB; NBS; NDK A; NDKA; NDP kinase A; NDPKA; NDPK-A; NM23A; NM23AWD; NM23H1; NM23-H1; NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; Tumor metastatic process-associated protein NME1 AWD, GAAD, NB, NBS, NDKA, NDPK-A, NDPKA, NM23, NM23-H1 NME/NM23 nucleoside diphosphate kinase 1 nucleoside diphosphate kinase A|NDP kinase A|epididymis secretory sperm binding protein|granzyme A-activated DNase|metastasis inhibition factor nm23|non-metastatic cells 1, protein (NM23A) expressed in|tumor metastatic process-associated protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NME1, check out the NME1 Infographic

NME1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NME1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP15531

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NM23A (NME1) (NM_000269) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NM23A (NME1) (NM_000269) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NM23A (NME1) (NM_000269) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP15531
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.