Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

Nicotinic Acetylcholine R alpha 4/CHRNA4 protein,

Purified recombinant protein of Homo sapiens cholinergic receptor, nicotinic, alpha 4 (CHRNA4)

Product Info Summary

SKU: PROTP43681
Size: 20 µg
Source: HEK293

Customers Who Bought This Also Bought

Product Name

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

View all Nicotinic Acetylcholine R alpha 4/CHRNA4 recombinant proteins

SKU/Catalog Number

PROTP43681

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens cholinergic receptor, nicotinic, alpha 4 (CHRNA4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP43681)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

69.9 kDa

Amino Acid Sequence

MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI

Validation Images & Assay Conditions

Gene/Protein Information For CHRNA4 (Source: Uniprot.org, NCBI)

Gene Name

CHRNA4

Full Name

Neuronal acetylcholine receptor subunit alpha-4

Weight

69.9 kDa

Superfamily

ligand-gated ion channel (TC 1.A.9) family

Alternative Names

nAchRa4; BFNC; cholinergic receptor, nicotinic, alpha 4; cholinergic receptor, nicotinic, alpha polypeptide 4; CHRNA4; EBN; EBN1; ENFL1; FLJ95812; nAChR alpha 4; NACHR; NACHRA4; NACRA4; neuronal acetylcholine receptor subunit alpha-4; neuronal nicotinic acetylcholine receptor alpha-4 subunit; Nicotinic Acetylcholine R alpha 4; Nicotinic Acetylcholine Ra4 CHRNA4 BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4 cholinergic receptor nicotinic alpha 4 subunit neuronal acetylcholine receptor subunit alpha-4|cholinergic receptor, nicotinic alpha 4|cholinergic receptor, nicotinic, alpha 4 (neuronal)|cholinergic receptor, nicotinic, alpha polypeptide 4|neuronal nicotinic acetylcholine receptor alpha-4 subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHRNA4, check out the CHRNA4 Infographic

CHRNA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHRNA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP43681

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP43681
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.