NHLH2 (NM_001111061) Human Recombinant Protein

NHLH2 protein,

Product Info Summary

SKU: PROTQ02577
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NHLH2 (NM_001111061) Human Recombinant Protein

View all NHLH2 recombinant proteins

SKU/Catalog Number

PROTQ02577

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nescient helix loop helix 2 (NHLH2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NHLH2 (NM_001111061) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ02577)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.8 kDa

Amino Acid Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For NHLH2 (Source: Uniprot.org, NCBI)

Gene Name

NHLH2

Full Name

Helix-loop-helix protein 2

Weight

14.8 kDa

Alternative Names

BHLHA34; bHLHa34NSCL-2; Class A basic helix-loop-helix protein 34; helix-loop-helix protein 2; HEN-2; HEN2NSCL2; nescient helix loop helix 2KIAA0490 NHLH2 HEN2, NSCL2, bHLHa34 nescient helix-loop-helix 2 helix-loop-helix protein 2|HEN-2|NSCL-2|class A basic helix-loop-helix protein 34

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NHLH2, check out the NHLH2 Infographic

NHLH2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NHLH2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used NHLH2 (NM_001111061) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NHLH2 (NM_001111061) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NHLH2 (NM_001111061) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ02577
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.