NDUFA2 (NM_002488) Human Recombinant Protein

NDUFA2 protein,

Product Info Summary

SKU: PROTO43678
Size: 20 µg
Source: HEK293T

Product Name

NDUFA2 (NM_002488) Human Recombinant Protein

View all NDUFA2 recombinant proteins

SKU/Catalog Number

PROTO43678

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa (NDUFA2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFA2 (NM_002488) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43678)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.7 kDa

Amino Acid Sequence

MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Validation Images & Assay Conditions

Gene/Protein Information For NDUFA2 (Source: Uniprot.org, NCBI)

Gene Name

NDUFA2

Full Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

Weight

10.7 kDa

Superfamily

complex I NDUFA2 subunit family

Alternative Names

B8; CD14; CIB8; CI-B8; complex I B8 subunit; Complex I-B8; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; NADH-ubiquinone oxidoreductase B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8 NDUFA2 B8, CD14, CIB8, MC1DN13 NADH:ubiquinone oxidoreductase subunit A2 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa|NADH-ubiquinone oxidoreductase subunit CI-B8|complex I B8 subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFA2, check out the NDUFA2 Infographic

NDUFA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43678

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFA2 (NM_002488) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFA2 (NM_002488) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFA2 (NM_002488) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43678
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.