NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

UBE2F/NCE2 protein,

Product Info Summary

SKU: PROTQ969M7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

View all UBE2F/NCE2 recombinant proteins

SKU/Catalog Number

PROTQ969M7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NCE2 (UBE2F) (NM_080678) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ969M7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.9 kDa

Amino Acid Sequence

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

Validation Images & Assay Conditions

Gene/Protein Information For Ube2f (Source: Uniprot.org, NCBI)

Gene Name

Ube2f

Full Name

NEDD8-conjugating enzyme UBE2F

Weight

20.9 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

EC 6.3.2; EC 6.3.2.-; MGC18120; NCE2; NCE2Ubiquitin-conjugating enzyme E2 F; NEDD8 carrier protein UBE2F; NEDD8 conjugating enzyme; NEDD8 protein ligase UBE2F; NEDD8-conjugating enzyme 2; NEDD8-conjugating enzyme UBE2F; UBE2F; ubiquitin-conjugating enzyme E2F (putative)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ube2f, check out the Ube2f Infographic

Ube2f infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ube2f: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ969M7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NCE2 (UBE2F) (NM_080678) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ969M7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.