NCBP2 (NM_001042540) Human Recombinant Protein

CBP20 protein,

Product Info Summary

SKU: PROTP52298
Size: 20 µg
Source: HEK293T

Product Name

NCBP2 (NM_001042540) Human Recombinant Protein

View all CBP20 recombinant proteins

SKU/Catalog Number

PROTP52298

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NCBP2 (NM_001042540) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52298)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.8 kDa

Amino Acid Sequence

MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ

Validation Images & Assay Conditions

Gene/Protein Information For NCBP2 (Source: Uniprot.org, NCBI)

Gene Name

NCBP2

Full Name

Nuclear cap-binding protein subunit 2

Weight

11.8 kDa

Superfamily

RRM NCBP2 family

Alternative Names

20 kDa nuclear cap-binding protein; Cbc2; CBP20CBC2; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; NIP1Cell proliferation-inducing gene 55 protein; nuclear cap binding protein subunit 2, 20kD; nuclear cap binding protein subunit 2, 20kDa; nuclear cap-binding protein subunit 2 NCBP2 CBC2, CBP20, NIP1, PIG55 nuclear cap binding protein subunit 2 nuclear cap-binding protein subunit 2|20 kDa nuclear cap-binding protein|NCBP 20 kDa subunit|NCBP interacting protein 1|cell proliferation-inducing gene 55 protein|nuclear cap binding protein subunit 2, 20kD|nuclear cap binding protein subunit 2, 20kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NCBP2, check out the NCBP2 Infographic

NCBP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NCBP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52298

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NCBP2 (NM_001042540) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NCBP2 (NM_001042540) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NCBP2 (NM_001042540) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52298
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.