NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein

DRAP1 protein,

Recombinant protein of human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1)

Product Info Summary

SKU: PROTQ14919
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein

View all DRAP1 recombinant proteins

SKU/Catalog Number

PROTQ14919

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14919)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.2 kDa

Amino Acid Sequence

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS

Validation Images & Assay Conditions

Gene/Protein Information For DRAP1 (Source: Uniprot.org, NCBI)

Gene Name

DRAP1

Full Name

Dr1-associated corepressor

Weight

22.2 kDa

Superfamily

NC2 alpha/DRAP1 family

Alternative Names

dr1-associated corepressor; DR1-associated protein 1 (negative cofactor 2 alpha); Dr1-associated protein 1; NC2-alphaNegative co-factor 2-alpha; negative cofactor 2 alpha DRAP1 NC2-alpha DR1 associated protein 1 dr1-associated corepressor|negative co-factor 2-alpha|negative cofactor 2 alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DRAP1, check out the DRAP1 Infographic

DRAP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DRAP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14919

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NC2 alpha (DRAP1) (NM_006442) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14919
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.