Click image to see more details
-
-
-
-
-
+2
Product Info Summary
| SKU: | A01424-2 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Lyn Antibody Picoband®
SKU/Catalog Number
A01424-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Lyn Antibody Picoband® catalog # A01424-2. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Lyn Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01424-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn, identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01424-2 is reactive to LYN in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
59 kDa
Calculated molecular weight
58574 MW
Background of LYN
Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01424-2 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human,
Positive Control
WB: human 293T whole cell
IHC: mouse intestine tissue, rat spleen tissue, human tonsil tissue, mouse spleen tissue, rat lymphaden tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 5. IHC analysis of Lyn using anti-Lyn antibody (A01424-2).
Lyn was detected in paraffin-embedded section of mouse intestine tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Lyn Antibody (A01424-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of Lyn using anti-Lyn antibody (A01424-2).
Lyn was detected in paraffin-embedded section of rat spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Lyn Antibody (A01424-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of Lyn using anti-Lyn antibody (A01424-2).
Lyn was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Lyn Antibody (A01424-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 2. IHC analysis of Lyn using anti-Lyn antibody (A01424-2).
Lyn was detected in paraffin-embedded section of mouse spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Lyn Antibody (A01424-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Lyn using anti-Lyn antibody (A01424-2).
Lyn was detected in paraffin-embedded section of rat lymphaden tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Lyn Antibody (A01424-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 1. Western blot analysis of Lyn using anti-Lyn antibody (A01424-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human 293T whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Lyn antigen affinity purified polyclonal antibody (Catalog # A01424-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Lyn at approximately 59KD. The expected band size for Lyn is at 59KD.
Protein Target Info & Infographic
Gene/Protein Information For LYN (Source: Uniprot.org, NCBI)
Gene Name
LYN
Full Name
Tyrosine-protein kinase Lyn
Weight
58574 MW
Superfamily
protein kinase superfamily
Alternative Names
Tyrosine-protein kinase Lyn;2.7.10.2;Lck/Yes-related novel protein tyrosine kinase;V-yes-1 Yamaguchi sarcoma viral related oncogene homolog;p53Lyn;p56Lyn;LYN;JTK8; LYN JTK8, p53Lyn, p56Lyn LYN proto-oncogene, Src family tyrosine kinase tyrosine-protein kinase Lyn|lck/Yes-related novel protein tyrosine kinase|v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on LYN, check out the LYN Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LYN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Lyn Antibody Picoband® (A01424-2)
Hello CJ!
No publications found for A01424-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Lyn Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Lyn Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Lyn Antibody Picoband®
Question
Does A01424-2 anti-Lyn antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
As indicated on the product datasheet, A01424-2 anti-Lyn antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-02
Question
Is this A01424-2 anti-Lyn antibody reactive to the isotypes of LYN?
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
The immunogen of A01424-2 anti-Lyn antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-13
Question
Is a blocking peptide available for product anti-Lyn antibody (A01424-2)?
Verified Customer
Verified customer
Asked: 2019-12-09
Answer
We do provide the blocking peptide for product anti-Lyn antibody (A01424-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-09
Question
Is there a BSA free version of anti-Lyn antibody A01424-2 available?
Verified Customer
Verified customer
Asked: 2019-11-21
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Lyn antibody A01424-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-21
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-Lyn antibody A01424-2. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-09-26
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-26
Question
We bought anti-Lyn antibody for WB on brain a few years ago. I am using mouse, and We intend to use the antibody for IHC next. I was wanting to use examining brain as well as blood in our next experiment. Could give a recommendation on which antibody would work the best for IHC?
W. Parker
Verified customer
Asked: 2019-02-13
Answer
I took a look at the website and datasheets of our anti-Lyn antibody and I see that A01424-2 has been validated on mouse in both WB and IHC. Thus A01424-2 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-02-13
Question
Will anti-Lyn antibody A01424-2 work for IHC with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-01-29
Answer
According to the expression profile of cervix carcinoma erythroleukemia, LYN is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-Lyn antibody A01424-2 will work for IHC with cervix carcinoma erythroleukemia.
Boster Scientific Support
Answered: 2019-01-29
Question
I was wanting to use your anti-Lyn antibody for IHC for mouse cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma erythroleukemia identification?
Verified Customer
Verified customer
Asked: 2018-07-30
Answer
As indicated on the product datasheet, A01424-2 anti-Lyn antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-07-30
Question
We have observed staining in human liver. Do you have any suggestions? Is anti-Lyn antibody supposed to stain liver positively?
Verified Customer
Verified customer
Asked: 2018-05-01
Answer
From literature liver does express LYN. From Uniprot.org, LYN is expressed in blood, platelet, brain, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have LYN expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11306681
Cervix carcinoma, Pubmed ID: 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 9171348, 18088087
Boster Scientific Support
Answered: 2018-05-01
Question
We are currently using anti-Lyn antibody A01424-2 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?
D. Li
Verified customer
Asked: 2017-11-29
Answer
The anti-Lyn antibody (A01424-2) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-11-29
Question
See below the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-Lyn antibody A01424-2. Please let me know if you require anything else.
A. Williams
Verified customer
Asked: 2017-05-15
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-05-15
Question
I am looking for to test anti-Lyn antibody A01424-2 on mouse cervix carcinoma erythroleukemia for research purposes, then I may be interested in using anti-Lyn antibody A01424-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
O. Parker
Verified customer
Asked: 2017-05-15
Answer
The products we sell, including anti-Lyn antibody A01424-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-05-15
Question
I see that the anti-Lyn antibody A01424-2 works with IHC, what is the protocol used to produce the result images on the product page?
H. Yang
Verified customer
Asked: 2016-02-23
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2016-02-23
Question
We were satisfied with the WB result of your anti-Lyn antibody. However we have seen positive staining in cervix carcinoma erythroleukemia cell membrane. nucleus. cytoplasm. using this antibody. Is that expected? Could you tell me where is LYN supposed to be expressed?
A. Miller
Verified customer
Asked: 2014-03-03
Answer
According to literature, cervix carcinoma erythroleukemia does express LYN. Generally LYN expresses in cell membrane. nucleus. cytoplasm. Regarding which tissues have LYN expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11306681
Cervix carcinoma, Pubmed ID: 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 9171348, 18088087
Boster Scientific Support
Answered: 2014-03-03
Question
I am interested in using your anti-Lyn antibody for response to toxic substance studies. Has this antibody been tested with western blotting on human tonsil tissue? We would like to see some validation images before ordering.
S. Banerjee
Verified customer
Asked: 2014-02-19
Answer
Thanks for your inquiry. This A01424-2 anti-Lyn antibody is tested on mouse spleen tissue, intestine tissue, rat lymphaden tissue, human tonsil tissue, 293t whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2014-02-19
Question
Can you help my question with product A01424-2, anti-Lyn antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
L. Carter
Verified customer
Asked: 2013-05-28
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01424-2 anti-Lyn antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-05-28
