mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein

mu Crystallin protein,

Product Info Summary

SKU: PROTQ14894
Size: 20 µg
Source: HEK293T

Product Name

mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein

View all mu Crystallin recombinant proteins

SKU/Catalog Number

PROTQ14894

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human crystallin, mu (CRYM), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14894)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.6 kDa

Amino Acid Sequence

MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

Validation Images & Assay Conditions

Gene/Protein Information For CRYM (Source: Uniprot.org, NCBI)

Gene Name

CRYM

Full Name

Ketimine reductase mu-crystallin

Weight

33.6 kDa

Superfamily

ornithine cyclodeaminase/mu-crystallin family

Alternative Names

crystallin, mu; DFNA40NADP-regulated thyroid-hormone binding protein; mu-crystallin homolog; NADP-regulated thyroid-hormone-binding protein; THBP CRYM DFNA40, THBP crystallin mu ketimine reductase mu-crystallin|NADP-regulated thyroid-hormone binding protein|mu-crystallin homolog|thiomorpholine-carboxylate dehydrogenase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRYM, check out the CRYM Infographic

CRYM infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRYM: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14894

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for mu Crystallin (CRYM) (NM_001888) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14894
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product