MTP18 (MTFP1) (NM_016498) Human Recombinant Protein

MTP18 protein,

Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Info Summary

SKU: PROTQ9UDX5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MTP18 (MTFP1) (NM_016498) Human Recombinant Protein

View all MTP18 recombinant proteins

SKU/Catalog Number

PROTQ9UDX5

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MTP18 (MTFP1) (NM_016498) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UDX5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.8 kDa

Amino Acid Sequence

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Validation Images & Assay Conditions

Gene/Protein Information For MTFP1 (Source: Uniprot.org, NCBI)

Gene Name

MTFP1

Full Name

Mitochondrial fission process protein 1

Weight

17.8 kDa

Superfamily

MTFP1 family

Alternative Names

HSPC242; Mitochondrial 18 kDa protein; mitochondrial fission process 1; mitochondrial fission process protein 1; mitochondrial protein 18 kDa; MTP18mitochondrial fission protein MTP18 MTFP1 HSPC242, MTP18 mitochondrial fission process 1 mitochondrial fission process protein 1|mitochondrial 18 kDa protein|mitochondrial fission protein MTP18|mitochondrial protein 18 kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MTFP1, check out the MTFP1 Infographic

MTFP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MTFP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UDX5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MTP18 (MTFP1) (NM_016498) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MTP18 (MTFP1) (NM_016498) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MTP18 (MTFP1) (NM_016498) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UDX5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.