MRPS6 (NM_032476) Human Recombinant Protein

MRPS6 protein,

Recombinant protein of human mitochondrial ribosomal protein S6 (MRPS6), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP82932
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MRPS6 (NM_032476) Human Recombinant Protein

View all MRPS6 recombinant proteins

SKU/Catalog Number

PROTP82932

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein S6 (MRPS6), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPS6 (NM_032476) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP82932)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14 kDa

Amino Acid Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Validation Images & Assay Conditions

Gene/Protein Information For MRPS6 (Source: Uniprot.org, NCBI)

Gene Name

MRPS6

Full Name

28S ribosomal protein S6, mitochondrial

Weight

14 kDa

Superfamily

bacterial ribosomal protein bS6 family

Alternative Names

C21orf101; mitochondrial ribosomal protein S6; MRP-S6chromosome 21 open reading frame 101; RPMS628S ribosomal protein S6, mitochondrial; S6mt MRPS6 C21orf101, MRP-S6, RPMS6, S6mt mitochondrial ribosomal protein S6 28S ribosomal protein S6, mitochondrial|mitochondrial small ribosomal subunit protein bS6m

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPS6, check out the MRPS6 Infographic

MRPS6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPS6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP82932

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPS6 (NM_032476) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPS6 (NM_032476) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPS6 (NM_032476) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP82932
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.