Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein

Ndufaf2 protein,

Product Info Summary

SKU: PROTQ8N183
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein

View all Ndufaf2 recombinant proteins

SKU/Catalog Number

PROTQ8N183

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N183)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ

Validation Images & Assay Conditions

Gene/Protein Information For Ndufaf2 (Source: Uniprot.org, NCBI)

Gene Name

Ndufaf2

Full Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2

Weight

19.7 kDa

Superfamily

complex I NDUFA12 subunit family

Alternative Names

B17.2LFLJ22398; B17.2-like; mimitin; MMTNmitochondrial; Myc-induced mitochondrial protein; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2; NDUFA12-like protein; NDUFA12-like Ndufaf2|1810058I14Rik, C86051, Ndufa, Ndufa12l, mim, mimitin|NADH:ubiquinone oxidoreductase complex assembly factor 2|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2|MMTN|Myc-induced mitochondria protein|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2|NDUFA12-like protein|mimitin, mitochondrial|myc-induced mitochondrial protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ndufaf2, check out the Ndufaf2 Infographic

Ndufaf2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ndufaf2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N183

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N183
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.