Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

CCL3 protein, Mouse

Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.

Product Info Summary

SKU: PROTP07141-3
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

View all CCL3 recombinant proteins

SKU/Catalog Number

PROTP07141-3

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07141-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

10.085kDa

Molecular weight

The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 10⁵ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CCL3 (Source: Uniprot.org, NCBI)

Gene Name

CCL3

Full Name

C-C motif chemokine 3

Weight

10.085kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

CSF-1, MGI-IM CCL3 G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3 C-C motif chemokine ligand 3 C-C motif chemokine 3|G0/G1 switch regulatory protein 19-1|PAT 464.1|SIS-beta|macrophage inflammatory protein 1-alpha|small inducible cytokine A3 (homologous to mouse Mip-1a)|tonsillar lymphocyte LD78 alpha protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL3, check out the CCL3 Infographic

CCL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP07141-3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

Size

Total: $77

SKU:PROTP07141-3

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP07141-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.