Click image to see more details
Product Info Summary
| SKU: | PROTQ8R459 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-38 (Interleukin-38) protein, AF
View all IL-38/IL-1F10 recombinant proteins
SKU/Catalog Number
PROTQ8R459
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 38 (IL-38) is a 16.87 kDa cytokine with 152 amino acid residues and a member of the interleukin-1 (IL-1) family. IL-38 is primarily secreted from basal epithelia of the skin and B cells of the tonsil, spleen, and thymus. It plays essential roles in inflammation and host defense by mediating NF-κB, AP1, and JNK signaling pathways when IL-38 binds to the receptors like IL1RAPL1 and IL-36R. In addition, IL-38 participates in down-regulating cell proliferation, migration, and up-regulating IL-6 and IL-10.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-38 (Interleukin-38) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8R459)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
16.943kDa
Molecular weight
The protein has a calculated MW of 17.89 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-38
Protein Target Info & Infographic
Gene/Protein Information For Il1f10 (Source: Uniprot.org, NCBI)
Gene Name
Il1f10
Full Name
Interleukin-1 family member 10
Weight
16.943kDa
Superfamily
IL-1 family
Alternative Names
interleukin 1 family, member 10, IL1F10 IL1F10 FIL1-theta, FKSG75, IL-1HY2, IL-38, IL1-theta, IL1HY2 interleukin 1 family member 10 interleukin-1 family member 10|FIL1 theta|IL-1 theta|IL-1F10 (canonical form IL-1F10a)|family of interleukin 1-theta|interleukin 1 family member 10 (theta)|interleukin-1 HY2|interleukin-1 receptor antagonist FKSG75|interleukin-1 receptor antagonist-like FIL1 theta|interleukin-38
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Il1f10, check out the Il1f10 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Il1f10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-38 (Interleukin-38) protein, AF (PROTQ8R459)
Hello CJ!
No publications found for PROTQ8R459
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-38 (Interleukin-38) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-38 (Interleukin-38) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
