Click image to see more details
Product Info Summary
| SKU: | PROTQ8R460-1 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF
View all IL-36 gamma/IL-1F9 recombinant proteins
SKU/Catalog Number
PROTQ8R460-1
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 36 gamma (IL-36 gamma) is a 17.65 kDa cytokine with 159 amino acid residues. IL-36 gamma is a member of the IL-1 family and is mainly expressed in keratinocytes, bronchial epithelial cells, macrophages, and monocyte. This cytokine responds to multiple pathogen-associated molecular patterns (PAMPs) and participates in the inflammatory response. In addition, it also induces the production of pro-inflammatory cytokines like IL-12, IL-1β, IL-6, TNF-α, and IL-23.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8R460-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
18.721kDa
Molecular weight
The protein has a calculated MW of 18.27 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10⁴ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-36 gamma
Protein Target Info & Infographic
Gene/Protein Information For IL36G (Source: Uniprot.org, NCBI)
Gene Name
IL36G
Full Name
Interleukin-36 gamma
Weight
18.721kDa
Superfamily
IL-1 family
Alternative Names
interleukin 1 family, member 9, IL-1F9,Il36g IL36G IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2 interleukin 36 gamma interleukin-36 gamma|IL-1 related protein 2|IL-1-epsilon|interleukin 1-related protein 2|interleukin-1 epsilon|interleukin-1 family member 9|interleukin-1 homolog 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL36G, check out the IL36G Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL36G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF (PROTQ8R460-1)
Hello CJ!
No publications found for PROTQ8R460-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
