IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

IL-36 gamma/IL-1F9 protein,

Product Info Summary

SKU: PROTQ9NZH8
Size: 20 µg
Source: HEK293T

Product Name

IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

View all IL-36 gamma/IL-1F9 recombinant proteins

SKU/Catalog Number

PROTQ9NZH8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interleukin 1 family, member 9 (IL1F9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZH8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.5 kDa

Amino Acid Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For IL36G (Source: Uniprot.org, NCBI)

Gene Name

IL36G

Full Name

Interleukin-36 gamma

Weight

18.5 kDa

Superfamily

IL-1 family

Alternative Names

IL-1 epsilon; IL-1 H1; IL-1 Related Protein 2; IL-1(EPSILON); IL1E; IL-1-epsilon; IL1F9; IL-1F9; IL1H1; IL-1H1; IL-1-Related Protein 2; IL1RP2; IL-1rp2; IL36 gamma; IL-36 gamma; IL36G; interleukin 1 family, member 9; interleukin 1-related protein 2; Interleukin 36, Gamma; Interleukin-1 epsilon; interleukin-1 family member 9; Interleukin-1 homolog 1; Interleukin-36 Gamma IL36G IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2 interleukin 36 gamma interleukin-36 gamma|IL-1 related protein 2|IL-1-epsilon|interleukin 1-related protein 2|interleukin-1 epsilon|interleukin-1 family member 9|interleukin-1 homolog 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL36G, check out the IL36G Infographic

IL36G infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL36G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NZH8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NZH8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.