Mouse recombinant IL-33 (Interleukin-33) protein, AF

IL-33 protein, Mouse

Interleukin 33 (IL-33) is a 17.65 kDa cytokine with 159 amino acid residues. IL-33 is a member of the IL-1 family and secreted from various cell types, such as mast cells, macrophages, endothelial cells, and epithelial cells. IL-33 activates NF-κB and MAPK signaling pathways that stimulate the secretion of type 2 cytokines like IL-5 and IL-13 when IL-33 binds to the ST2 receptor primarily expressed in mast cells and Th2 cells. In addition to Th type 2 responses, IL-33 participates in maintaining barrier tissue defense.

Product Info Summary

SKU: PROTQ8BVZ5-4
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant IL-33 (Interleukin-33) protein, AF

View all IL-33 recombinant proteins

SKU/Catalog Number

PROTQ8BVZ5-4

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Interleukin 33 (IL-33) is a 17.65 kDa cytokine with 159 amino acid residues. IL-33 is a member of the IL-1 family and secreted from various cell types, such as mast cells, macrophages, endothelial cells, and epithelial cells. IL-33 activates NF-κB and MAPK signaling pathways that stimulate the secretion of type 2 cytokines like IL-5 and IL-13 when IL-33 binds to the ST2 receptor primarily expressed in mast cells and Th2 cells. In addition to Th type 2 responses, IL-33 participates in maintaining barrier tissue defense.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant IL-33 (Interleukin-33) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8BVZ5-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

29.991kDa

Molecular weight

The protein has a calculated MW of 18.51 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is > 2 x 10⁷ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL33 (Source: Uniprot.org, NCBI)

Gene Name

IL33

Full Name

Interleukin-33

Weight

29.991kDa

Superfamily

IL-1 family

Alternative Names

IL-1 F11, NF-HEV, 9230117N10Rik Il33|9230117N10Rik, Il-, Il-33, Il1f, Il1f11, NF-H, NF-HEV|interleukin 33|interleukin-33|nuclear factor from high endothelial venules

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL33, check out the IL33 Infographic

IL33 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL33: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8BVZ5-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant IL-33 (Interleukin-33) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant IL-33 (Interleukin-33) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant IL-33 (Interleukin-33) protein, AF

Size

Total: $77

SKU:PROTQ8BVZ5-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ8BVZ5-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.