Click image to see more details
Product Info Summary
| SKU: | PROTQ8BVZ5-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-33 (Interleukin-33) protein, AF
View all IL-33 recombinant proteins
SKU/Catalog Number
PROTQ8BVZ5-4
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin 33 (IL-33) is a 17.65 kDa cytokine with 159 amino acid residues. IL-33 is a member of the IL-1 family and secreted from various cell types, such as mast cells, macrophages, endothelial cells, and epithelial cells. IL-33 activates NF-κB and MAPK signaling pathways that stimulate the secretion of type 2 cytokines like IL-5 and IL-13 when IL-33 binds to the ST2 receptor primarily expressed in mast cells and Th2 cells. In addition to Th type 2 responses, IL-33 participates in maintaining barrier tissue defense.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-33 (Interleukin-33) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8BVZ5-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
29.991kDa
Molecular weight
The protein has a calculated MW of 18.51 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is > 2 x 10⁷ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-33
Protein Target Info & Infographic
Gene/Protein Information For IL33 (Source: Uniprot.org, NCBI)
Gene Name
IL33
Full Name
Interleukin-33
Weight
29.991kDa
Superfamily
IL-1 family
Alternative Names
IL-1 F11, NF-HEV, 9230117N10Rik Il33|9230117N10Rik, Il-, Il-33, Il1f, Il1f11, NF-H, NF-HEV|interleukin 33|interleukin-33|nuclear factor from high endothelial venules
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL33, check out the IL33 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL33: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-33 (Interleukin-33) protein, AF (PROTQ8BVZ5-4)
Hello CJ!
No publications found for PROTQ8BVZ5-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-33 (Interleukin-33) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-33 (Interleukin-33) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
