Click image to see more details
Product Info Summary
| SKU: | PROTP43432-1 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-12 p40 (Interleukin-12 p40) protein, AF
View all Il12b recombinant proteins
SKU/Catalog Number
PROTP43432-1
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin 12 (IL-12) is a pro-inflammatory cytokine with a molecular weight of 70 kDa composed of two subunits, IL-12 p35 (35 kDa) and IL-12 p40 (40 kDa). IL-12 p40 is induced in excess over the other subunits of IL-12 and IL-23 and can exist in a monomeric or homodimeric form.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-12 p40 (Interleukin-12 p40) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP43432-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
37.169kDa
Molecular weight
The protein has a calculated MW of 36.60 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED₅₀ for this effect is <0.3 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-12 p40
Protein Target Info & Infographic
Gene/Protein Information For IL12B (Source: Uniprot.org, NCBI)
Gene Name
IL12B
Full Name
Interleukin-12 subunit beta
Weight
37.169kDa
Superfamily
IL-12B family
Alternative Names
Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2 IL12B CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2 interleukin 12B interleukin-12 subunit beta|CLMF p40|IL-12 subunit p40|IL12, subunit p40|NK cell stimulatory factor chain 2|cytotoxic lymphocyte maturation factor 40 kDa subunit|interleukin 12, p40|interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)|interleukin-12 beta chain|natural killer cell stimulatory factor, 40 kD subunit
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL12B, check out the IL12B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL12B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-12 p40 (Interleukin-12 p40) protein, AF (PROTP43432-1)
Hello CJ!
No publications found for PROTP43432-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-12 p40 (Interleukin-12 p40) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-12 p40 (Interleukin-12 p40) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
