Click image to see more details
Product Info Summary
| SKU: | PROTP09920-2 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
View all G-CSF recombinant proteins
SKU/Catalog Number
PROTP09920-2
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (N-term)
Description
Granulocyte Colony-Stimulating Factor (G-CSF) is a 18.67 kDa protein containing 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, and development of myeloid cells. G-CSF is a member of the CSF family of glycoproteins, and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment. G-CSF is also an established useful clinical agent for increasing neutrophilic granulocytes levels. Mouse G-CSF shares 73% sequence homology with human G-CSF.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09920-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.293kDa
Molecular weight
The protein has a calculated MW of 19.76 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse G-CSF is > 2 x 10⁷ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA with polyhistidine tag at the N- terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse G-CSF
Protein Target Info & Infographic
Gene/Protein Information For CSF3 (Source: Uniprot.org, NCBI)
Gene Name
CSF3
Full Name
Granulocyte colony-stimulating factor
Weight
22.293kDa
Superfamily
IL-6 superfamily
Alternative Names
CSF-3, MGI-1G, GM-CSF beta, pluripoietin CSF3 C17orf33OS, GCSF, CSF3 colony stimulating factor 3 granulocyte colony-stimulating factor|filgrastim|granulocyte-colony stimulating factor|lenograstim|pluripoietin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CSF3, check out the CSF3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CSF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF (PROTP09920-2)
Hello CJ!
No publications found for PROTP09920-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
