Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

G-CSF protein, Mouse

Granulocyte Colony-Stimulating Factor (G-CSF) is a 18.67 kDa protein containing 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, and development of myeloid cells. G-CSF is a member of the CSF family of glycoproteins, and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment. G-CSF is also an established useful clinical agent for increasing neutrophilic granulocytes levels. Mouse G-CSF shares 73% sequence homology with human G-CSF.

Product Info Summary

SKU: PROTP09920-2
Size: 5ug,20ug,100ug,500ug,1mg
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

View all G-CSF recombinant proteins

SKU/Catalog Number

PROTP09920-2

Size

5ug,20ug,100ug,500ug,1mg

Tag

His Tag (N-term)

Description

Granulocyte Colony-Stimulating Factor (G-CSF) is a 18.67 kDa protein containing 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, and development of myeloid cells. G-CSF is a member of the CSF family of glycoproteins, and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment. G-CSF is also an established useful clinical agent for increasing neutrophilic granulocytes levels. Mouse G-CSF shares 73% sequence homology with human G-CSF.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09920-2)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

22.293kDa

Molecular weight

The protein has a calculated MW of 19.76 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse G-CSF is > 2 x 10⁷ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA with polyhistidine tag at the N- terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CSF3 (Source: Uniprot.org, NCBI)

Gene Name

CSF3

Full Name

Granulocyte colony-stimulating factor

Weight

22.293kDa

Superfamily

IL-6 superfamily

Alternative Names

CSF-3, MGI-1G, GM-CSF beta, pluripoietin CSF3 C17orf33OS, GCSF, CSF3 colony stimulating factor 3 granulocyte colony-stimulating factor|filgrastim|granulocyte-colony stimulating factor|lenograstim|pluripoietin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSF3, check out the CSF3 Infographic

CSF3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09920-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

Size

Total: $77

SKU:PROTP09920-2

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP09920-2
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.