Product Info Summary
SKU: | PROTP12850-4 |
---|---|
Size: | 5ug,20ug,100ug,500ug,1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF
View all CXCL1/GRO alpha/KC/CINC-1 recombinant proteins
SKU/Catalog Number
PROTP12850-4
Size
5ug,20ug,100ug,500ug,1mg
Tag
Tag Free
Description
C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12850-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
11.301kDa
Molecular weight
The protein has a calculated MW of 7.45 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <15 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL1
Protein Target Info & Infographic
Gene/Protein Information For CXCL1 (Source: Uniprot.org, NCBI)
Gene Name
CXCL1
Full Name
Growth-regulated alpha protein
Weight
11.301kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
GRO-α: MGSAα, NAP-3, GRO1, KC (murine) CXCL1 FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1 C-X-C motif chemokine ligand 1 growth-regulated alpha protein|C-X-C motif chemokine 1|GRO-alpha(1-73)|GRO1 oncogene (melanoma growth stimulating activity, alpha)|GRO1 oncogene (melanoma growth-stimulating activity)|MGSA alpha|chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)|fibroblast secretory protein|melanoma growth stimulating activity, alpha|melanoma growth stimulatory activity alpha|neutrophil-activating protein 3
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL1, check out the CXCL1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF (PROTP12850-4)
Hello CJ!
No publications found for PROTP12850-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question