Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF

CXCL1/GRO alpha/KC/CINC-1 protein, Mouse

C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.

Product Info Summary

SKU: PROTP12850-4
Size: 5ug,20ug,100ug,500ug,1mg
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF

View all CXCL1/GRO alpha/KC/CINC-1 recombinant proteins

SKU/Catalog Number

PROTP12850-4

Size

5ug,20ug,100ug,500ug,1mg

Tag

Tag Free

Description

C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12850-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Purity

>95% as determined by SDS-PAGE.

Predicted MW

11.301kDa

Molecular weight

The protein has a calculated MW of 7.45 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <15 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL1 (Source: Uniprot.org, NCBI)

Gene Name

CXCL1

Full Name

Growth-regulated alpha protein

Weight

11.301kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

GRO-α: MGSAα, NAP-3, GRO1, KC (murine) CXCL1 FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1 C-X-C motif chemokine ligand 1 growth-regulated alpha protein|C-X-C motif chemokine 1|GRO-alpha(1-73)|GRO1 oncogene (melanoma growth stimulating activity, alpha)|GRO1 oncogene (melanoma growth-stimulating activity)|MGSA alpha|chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)|fibroblast secretory protein|melanoma growth stimulating activity, alpha|melanoma growth stimulatory activity alpha|neutrophil-activating protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL1, check out the CXCL1 Infographic

CXCL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP12850-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF

Size

Total: $77

SKU:PROTP12850-4

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP12850-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.