Product Info Summary
SKU: | PROTP10855-4 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF
View all CCL3 recombinant proteins
SKU/Catalog Number
PROTP10855-4
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
C-C Motif Chemokine Ligand 3 (CCL3) is a 7.66 kDa cytokine with 69 amino acid residues. CCL3, also known as macrophage inflammatory protein 1-alpha (MIP-1-alpha), is expressed in the spleen, lung, and articular cartilage. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays a vital role in immune response, such as inflammation, recruitment of immune cells, and production of IL-1β and TNF. In addition, CCL3 also participates in resistance to type 1 virus infection, astrocyte cell migration, regulation of macromolecule metabolic process, and regulation of ERK1 and ERK2 cascade.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10855-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
10.085kDa
Molecular weight
The protein has a calculated MW of 8.69 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CCL3
Protein Target Info & Infographic
Gene/Protein Information For CCL3 (Source: Uniprot.org, NCBI)
Gene Name
CCL3
Full Name
C-C motif chemokine 3
Weight
10.085kDa
Superfamily
intercrine beta (chemokine CC) family
Alternative Names
MIP-1a: Macrophage Inflammatory Protein-1α, LD78α CCL3 G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3 C-C motif chemokine ligand 3 C-C motif chemokine 3|G0/G1 switch regulatory protein 19-1|PAT 464.1|SIS-beta|macrophage inflammatory protein 1-alpha|small inducible cytokine A3 (homologous to mouse Mip-1a)|tonsillar lymphocyte LD78 alpha protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CCL3, check out the CCL3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF (PROTP10855-4)
Hello CJ!
No publications found for PROTP10855-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question