Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF

CCL2 protein, Mouse

C-C Motif Chemokine Ligand 2 (CCL2) is a 13.88 kDa cytokine with 125 amino acid residues and is also known as monocyte chemoattractant protein 1 (MCP1). CCL2 is mainly secreted from monocytes, macrophages, and dendritic cells. It regulates many biological functions, such as recruitments of monocytes, memory T cells, eosinophils, and dendritic cells, extravasation of helper T cells, response to TNFα and IFNγ, and angiogenesis. In addition, upon binding with CCR4, it initiates leukocyte migration response to inflammation.

Product Info Summary

SKU: PROTP10148-4
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF

View all CCL2 recombinant proteins

SKU/Catalog Number

PROTP10148-4

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-C Motif Chemokine Ligand 2 (CCL2) is a 13.88 kDa cytokine with 125 amino acid residues and is also known as monocyte chemoattractant protein 1 (MCP1). CCL2 is mainly secreted from monocytes, macrophages, and dendritic cells. It regulates many biological functions, such as recruitments of monocytes, memory T cells, eosinophils, and dendritic cells, extravasation of helper T cells, response to TNFα and IFNγ, and angiogenesis. In addition, upon binding with CCR4, it initiates leukocyte migration response to inflammation.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10148-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

11.025kDa

Molecular weight

The protein has a calculated MW of 14.65 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED₅₀ for this effect is <8 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CCL2 (Source: Uniprot.org, NCBI)

Gene Name

CCL2

Full Name

C-C motif chemokine 2

Weight

11.025kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

Monocyte Chemotactic Protein-1,MCP-1,JE CCL2 GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF C-C motif chemokine ligand 2 C-C motif chemokine 2|chemokine (C-C motif) ligand 2|monocyte chemoattractant protein-1|monocyte chemotactic and activating factor|monocyte chemotactic protein 1|monocyte secretory protein JE|small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je)|small inducible cytokine subfamily A (Cys-Cys), member 2|small-inducible cytokine A2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL2, check out the CCL2 Infographic

CCL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP10148-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant CCL2 (C-C motif chemokine ligand 2) protein, AF

Size

Total: $77

SKU:PROTP10148-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP10148-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product