MMP19 (NM_002429) Human Recombinant Protein

MMP-19 protein,

Recombinant protein of human matrix metallopeptidase 19 (MMP19), transcript variant 1

Product Info Summary

SKU: PROTQ99542
Size: 20 µg
Source: HEK293T

Product Name

MMP19 (NM_002429) Human Recombinant Protein

View all MMP-19 recombinant proteins

SKU/Catalog Number

PROTQ99542

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human matrix metallopeptidase 19 (MMP19), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MMP19 (NM_002429) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99542)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

55.3 kDa

Amino Acid Sequence

MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY

Validation Images & Assay Conditions

Gene/Protein Information For MMP19 (Source: Uniprot.org, NCBI)

Gene Name

MMP19

Full Name

Matrix metalloproteinase-19

Weight

55.3 kDa

Superfamily

peptidase M10A family

Alternative Names

EC 3.4.24.-; matrix metallopeptidase 19; matrix metalloproteinase 18; matrix metalloproteinase 19; Matrix metalloproteinase RASI; Matrix metalloproteinase-18; matrix metalloproteinase-19; MMP-18; MMP18MMP-19; MMP19; MMP-19; RASI; RASI-1 MMP19 CODA, MMP18, RASI-1 matrix metallopeptidase 19 matrix metalloproteinase-19|matrix metalloproteinase RASI|matrix metalloproteinase-18|matrix metalloproteinase-beta19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MMP19, check out the MMP19 Infographic

MMP19 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MMP19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99542

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MMP19 (NM_002429) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MMP19 (NM_002429) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MMP19 (NM_002429) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99542
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product