MKRN2 (NM_014160) Human Recombinant Protein

MKRN2 protein,

Recombinant protein of human makorin ring finger protein 2 (MKRN2)

Product Info Summary

SKU: PROTQ9H000
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MKRN2 (NM_014160) Human Recombinant Protein

View all MKRN2 recombinant proteins

SKU/Catalog Number

PROTQ9H000

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human makorin ring finger protein 2 (MKRN2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MKRN2 (NM_014160) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H000)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.8 kDa

Amino Acid Sequence

MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP

Validation Images & Assay Conditions

Gene/Protein Information For MKRN2 (Source: Uniprot.org, NCBI)

Gene Name

MKRN2

Full Name

Probable E3 ubiquitin-protein ligase makorin-2

Weight

46.8 kDa

Alternative Names

EC 6.3.2.-; HSPC070; makorin ring finger protein 2; probable E3 ubiquitin-protein ligase makorin-2; RNF62RING finger protein 62 MKRN2 HSPC070, RNF62 makorin ring finger protein 2 probable E3 ubiquitin-protein ligase makorin-2|RING finger protein 62|RING-type E3 ubiquitin transferase makorin-2|makorin RING zinc-finger protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MKRN2, check out the MKRN2 Infographic

MKRN2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MKRN2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H000

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MKRN2 (NM_014160) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MKRN2 (NM_014160) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MKRN2 (NM_014160) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H000
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.