MINPP1 (NM_004897) Human Recombinant Protein

MINPP1 protein,

Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1)

Product Info Summary

SKU: PROTQ9UNW1
Size: 20 µg
Source: HEK293T

Product Name

MINPP1 (NM_004897) Human Recombinant Protein

View all MINPP1 recombinant proteins

SKU/Catalog Number

PROTQ9UNW1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MINPP1 (NM_004897) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UNW1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

54.9 kDa

Amino Acid Sequence

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

Validation Images & Assay Conditions

Gene/Protein Information For MINPP1 (Source: Uniprot.org, NCBI)

Gene Name

MINPP1

Full Name

Multiple inositol polyphosphate phosphatase 1

Weight

54.9 kDa

Superfamily

histidine acid phosphatase family

Alternative Names

EC 3.1.3.62; HIPER1; Inositol (13,4,5)-tetrakisphosphate 3-phosphatase; Ins(13,4,5)P(4) 3-phosphatase; MINPP2; MIPPDKFZp564L2016; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; multiple inositol polyphosphate phosphatase 2; multiple inositol-polyphosphate phosphatase 1 MINPP1 HIPER1, MINPP2, MIPP multiple inositol-polyphosphate phosphatase 1 multiple inositol polyphosphate phosphatase 1|2,3-BPG phosphatase|2,3-bisphosphoglycerate 3-phosphatase|inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase|ins(1,3,4,5)P(4) 3-phosphatase|multiple inositol polyphosphate histidine phosphatase, 1|multiple inositol polyphosphate phosphatase 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MINPP1, check out the MINPP1 Infographic

MINPP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MINPP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UNW1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MINPP1 (NM_004897) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MINPP1 (NM_004897) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MINPP1 (NM_004897) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UNW1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.