MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein

Pdcd2l protein,

Recombinant protein of human programmed cell death 2-like (PDCD2L)

Product Info Summary

SKU: PROTQ9BRP1
Size: 20 µg
Source: HEK293T

Product Name

MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein

View all Pdcd2l recombinant proteins

SKU/Catalog Number

PROTQ9BRP1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human programmed cell death 2-like (PDCD2L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRP1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.2 kDa

Amino Acid Sequence

MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK

Validation Images & Assay Conditions

Gene/Protein Information For Pdcd2l (Source: Uniprot.org, NCBI)

Gene Name

Pdcd2l

Full Name

Programmed cell death protein 2-like

Weight

39.2 kDa

Alternative Names

MGC13096; programmed cell death 2-like; programmed cell death protein 2-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Pdcd2l, check out the Pdcd2l Infographic

Pdcd2l infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Pdcd2l: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRP1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRP1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.