MFGE8 (NM_005928) Human Recombinant Protein

MFG-E8 protein,

Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1

Product Info Summary

SKU: PROTQ08431
Size: 20 µg
Source: HEK293T

Product Name

MFGE8 (NM_005928) Human Recombinant Protein

View all MFG-E8 recombinant proteins

SKU/Catalog Number

PROTQ08431

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MFGE8 (NM_005928) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ08431)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.9 kDa

Amino Acid Sequence

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Validation Images & Assay Conditions

Gene/Protein Information For MFGE8 (Source: Uniprot.org, NCBI)

Gene Name

MFGE8

Full Name

Lactadherin

Weight

42.9 kDa

Alternative Names

BA46; Breast epithelial antigen BA46; EDIL1; hP47; HsT19888; lactadherin; Lactahedrin; Medin; MFG1; MFGE8; MFG-E8; MFGM; milk fat globule-EGF factor 8 protein; Milk fat globule-EGF factor 8; O-acetyl disialoganglioside synthase; OAcGD3S; SED1; SPAG10; sperm associated antigen 10; sperm surface protein hP47 MFGE8 BA46, EDIL1, HMFG, HsT19888, MFG-E8, MFGM, OAcGD3S, SED1, SPAG10, hP47 milk fat globule EGF and factor V/VIII domain containing lactadherin|O-acetyl disialoganglioside synthase|breast epithelial BA46|medin|milk fat globule-EGF factor 8 protein|sperm associated 10|sperm surface protein hP47

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MFGE8, check out the MFGE8 Infographic

MFGE8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MFGE8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ08431

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MFGE8 (NM_005928) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MFGE8 (NM_005928) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MFGE8 (NM_005928) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ08431
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.