MED4 (NM_014166) Human Recombinant Protein

MED4 protein,

Product Info Summary

SKU: PROTQ9NPJ6
Size: 20 µg
Source: HEK293T

Product Name

MED4 (NM_014166) Human Recombinant Protein

View all MED4 recombinant proteins

SKU/Catalog Number

PROTQ9NPJ6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 4 (MED4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MED4 (NM_014166) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NPJ6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.6 kDa

Amino Acid Sequence

MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD

Validation Images & Assay Conditions

Gene/Protein Information For MED4 (Source: Uniprot.org, NCBI)

Gene Name

MED4

Full Name

Mediator of RNA polymerase II transcription subunit 4

Weight

29.6 kDa

Superfamily

Mediator complex subunit 4 family

Alternative Names

Activator-recruited cofactor 36 kDa component; ARC36; DRIP36; DRIP36mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae); FLJ10956; HSPC126; HSPC126vitamin D receptor interacting protein; MED4; mediator complex subunit 4TRAP/SMCC/PC2 subunit p36 subunit; subunit 4 homolog; TRAP36; VDRIP MED4 ARC36, DRIP36, HSPC126, TRAP36, VDRIP mediator complex subunit 4 mediator of RNA polymerase II transcription subunit 4|activator-recruited cofactor 36 kDa component|mediator, 34-kD subunit, homolog|vitamin D receptor-interacting protein, 36-kD|vitamin D3 receptor-interacting protein complex 36 kDa component

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED4, check out the MED4 Infographic

MED4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NPJ6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MED4 (NM_014166) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MED4 (NM_014166) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MED4 (NM_014166) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NPJ6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.