MED31 (NM_016060) Human Recombinant Protein

MED31 protein,

Recombinant protein of human mediator complex subunit 31 (MED31)

Product Info Summary

SKU: PROTQ9Y3C7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MED31 (NM_016060) Human Recombinant Protein

View all MED31 recombinant proteins

SKU/Catalog Number

PROTQ9Y3C7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 31 (MED31)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MED31 (NM_016060) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3C7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.6 kDa

Amino Acid Sequence

MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

Validation Images & Assay Conditions

Gene/Protein Information For MED31 (Source: Uniprot.org, NCBI)

Gene Name

MED31

Full Name

Mediator of RNA polymerase II transcription subunit 31

Weight

15.6 kDa

Superfamily

Mediator complex subunit 31 family

Alternative Names

CGI-125; FLJ27436; FLJ36714; hSOH1; mediator complex subunit 313110004H13Rik; Mediator complex subunit SOH1; mediator of RNA polymerase II transcription subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription, subunit 31 homolog; Soh1 MED31 3110004H13Rik, CGI-125, Soh1 mediator complex subunit 31 mediator of RNA polymerase II transcription subunit 31|hSOH1|mediator complex subunit SOH1|mediator of RNA polymerase II transcription, subunit 31 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED31, check out the MED31 Infographic

MED31 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED31: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3C7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MED31 (NM_016060) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MED31 (NM_016060) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MED31 (NM_016060) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3C7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.