IL17E Interleukin-17E Mouse Recombinant Protein

IL-17E/IL-25 protein, Mouse

Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ8VHH8
Size: 5ug, 25ug, 1mg
Origin Species: Mouse
Source: Escherichia coli

Product Name

IL17E Interleukin-17E Mouse Recombinant Protein

View all IL-17E/IL-25 recombinant proteins

SKU/Catalog Number

PROTQ8VHH8

Size

5ug, 25ug, 1mg

Description

Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IL17E Interleukin-17E Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8VHH8)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.

Purity

Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS PPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRD LNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV CVRPRVMA

Biological Activity

The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.

Reconstitution

It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL25 (Source: Uniprot.org, NCBI)

Gene Name

IL25

Full Name

Interleukin-25

Weight

Superfamily

IL-17 family

Alternative Names

IL17E; IL-17E; IL25; IL-25; interleukin 25; Interleukin-17E; interleukin-25 IL25 IL17E interleukin 25 interleukin-25|interleukin-17E

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL25, check out the IL25 Infographic

IL25 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL25: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8VHH8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL17E Interleukin-17E Mouse Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL17E Interleukin-17E Mouse Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL17E Interleukin-17E Mouse Recombinant Protein

Size

Total: $250

SKU:PROTQ8VHH8

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ8VHH8
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.