Product Info Summary
SKU: | PROTQ8VHH8 |
---|---|
Size: | 5ug, 25ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL17E Interleukin-17E Mouse Recombinant Protein
View all IL-17E/IL-25 recombinant proteins
SKU/Catalog Number
PROTQ8VHH8
Size
5ug, 25ug, 1mg
Description
Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL17E Interleukin-17E Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8VHH8)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS PPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRD LNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV CVRPRVMA
Biological Activity
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL25 (Source: Uniprot.org, NCBI)
Gene Name
IL25
Full Name
Interleukin-25
Weight
Superfamily
IL-17 family
Alternative Names
IL17E; IL-17E; IL25; IL-25; interleukin 25; Interleukin-17E; interleukin-25 IL25 IL17E interleukin 25 interleukin-25|interleukin-17E
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL25, check out the IL25 Infographic
![IL25 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL25: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL17E Interleukin-17E Mouse Recombinant Protein (PROTQ8VHH8)
Hello CJ!
No publications found for PROTQ8VHH8
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL17E Interleukin-17E Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL17E Interleukin-17E Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question