MED30 (NM_080651) Human Recombinant Protein

Med30 protein,

Recombinant protein of human mediator complex subunit 30 (MED30)

Product Info Summary

SKU: PROTQ96HR3
Size: 20 µg
Source: HEK293T

Product Name

MED30 (NM_080651) Human Recombinant Protein

View all Med30 recombinant proteins

SKU/Catalog Number

PROTQ96HR3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 30 (MED30)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MED30 (NM_080651) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96HR3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.1 kDa

Amino Acid Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Validation Images & Assay Conditions

Gene/Protein Information For MED30 (Source: Uniprot.org, NCBI)

Gene Name

MED30

Full Name

Mediator of RNA polymerase II transcription subunit 30

Weight

20.1 kDa

Superfamily

Mediator complex subunit 30 family

Alternative Names

mediator complex subunit 30TRAP/Mediator complex component TRAP25; mediator of RNA polymerase II transcription subunit 30; putative mediator of RNA polymerase II transcription subunit 30; THRAP6MGC9890; thyroid hormone receptor associated protein 6; Thyroid hormone receptor-associated protein 6; Thyroid hormone receptor-associated protein complex 25 kDa component; Trap25; TRAP25MED30S Med30|1810038N03Rik, 2510044J04Rik, TRAP25, Thr, Thrap6, Tra|mediator complex subunit 30|mediator of RNA polymerase II transcription subunit 30|TRAP/Mediator complex component TRAP25|thyroid hormone receptor associated protein 6|thyroid hormone receptor-associated protein complex 25 kDa component

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED30, check out the MED30 Infographic

MED30 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED30: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96HR3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MED30 (NM_080651) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MED30 (NM_080651) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MED30 (NM_080651) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96HR3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.