MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein

MECP2 protein, Human

MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.

Product Info Summary

SKU: PROTP51608
Size: 2ug, 10ug, 0.1mg
Origin Species: Human
Source: Mammalian system, 293 cells

Customers Who Bought This Also Bought

Product Name

MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein

View all MECP2 recombinant proteins

SKU/Catalog Number

PROTP51608

Size

2ug, 10ug, 0.1mg

Description

MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.

Storage & Handling

MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51608)

Form

Sterile Filtered colorless solution.

Formulation

The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide.

Purity

Greater than 80% as determined by SDS-PAGE.

Amino Acid Sequence

MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA EPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAG KYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMV IKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIE VKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVP LLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAA EKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS

Validation Images & Assay Conditions

Gene/Protein Information For MECP2 (Source: Uniprot.org, NCBI)

Gene Name

MECP2

Full Name

Methyl-CpG-binding protein 2

Weight

Alternative Names

AUTSX3; DKFZp686A24160; MeCp-2 protein; mental retardation, X-linked 79; methyl CpG binding protein 2 (Rett syndrome); X-linked 16 MECP2 AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RS, RTS, RTT methyl-CpG binding protein 2 methyl-CpG-binding protein 2|meCp-2 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MECP2, check out the MECP2 Infographic

MECP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MECP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51608

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MECP2 Methyl CpG Binding Protein 2 Human Recombinant Protein

Size

Total: $250

SKU:PROTP51608

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP51608
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.