MBNL3 (NM_018388) Human Recombinant Protein

MBNL3 protein,

Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G

Product Info Summary

SKU: PROTQ9NUK0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MBNL3 (NM_018388) Human Recombinant Protein

View all MBNL3 recombinant proteins

SKU/Catalog Number

PROTQ9NUK0

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MBNL3 (NM_018388) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NUK0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.4 kDa

Amino Acid Sequence

MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF

Validation Images & Assay Conditions

Gene/Protein Information For MBNL3 (Source: Uniprot.org, NCBI)

Gene Name

MBNL3

Full Name

Muscleblind-like protein 3

Weight

38.4 kDa

Superfamily

muscleblind family

Alternative Names

CHCRMBLX39FLJ11316; Cys3His CCG1-required protein; FLJ97142; MBXLMBLX; muscleblind-like 3 (Drosophila); muscleblind-like protein 3; Muscleblind-like X-linked protein; Protein HCHCR MBNL3 CHCR, MBLX, MBLX39, MBXL muscleblind like splicing regulator 3 muscleblind-like protein 3|Cys3His CCG1-required protein|muscleblind-like 3|muscleblind-like X-linked protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MBNL3, check out the MBNL3 Infographic

MBNL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MBNL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NUK0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MBNL3 (NM_018388) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MBNL3 (NM_018388) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MBNL3 (NM_018388) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NUK0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.