MAGEF1 (NM_022149) Human Recombinant Protein

MAGEF1 protein,

Recombinant protein of human melanoma antigen family F, 1 (MAGEF1)

Product Info Summary

SKU: PROTQ9HAY2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MAGEF1 (NM_022149) Human Recombinant Protein

View all MAGEF1 recombinant proteins

SKU/Catalog Number

PROTQ9HAY2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human melanoma antigen family F, 1 (MAGEF1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAGEF1 (NM_022149) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HAY2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35 kDa

Amino Acid Sequence

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKSLARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPAYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW

Validation Images & Assay Conditions

Gene/Protein Information For MAGEF1 (Source: Uniprot.org, NCBI)

Gene Name

MAGEF1

Full Name

Melanoma-associated antigen F1

Weight

35 kDa

Alternative Names

MAGE-F1 antigen; melanoma antigen family F, 1; melanoma-associated antigen F1; MGC19617 MAGEF1 MAGE-F1 MAGE family member F1 melanoma-associated antigen F1|MAGE-F1 antigen|melanoma antigen family F, 1|melanoma antigen family F1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAGEF1, check out the MAGEF1 Infographic

MAGEF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAGEF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HAY2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAGEF1 (NM_022149) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAGEF1 (NM_022149) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAGEF1 (NM_022149) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HAY2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.