LSM10 (NM_032881) Human Recombinant Protein

LSM10 protein,

Recombinant protein of human LSM10, U7 small nuclear RNA associated (LSM10)

Product Info Summary

SKU: PROTQ969L4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LSM10 (NM_032881) Human Recombinant Protein

View all LSM10 recombinant proteins

SKU/Catalog Number

PROTQ969L4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LSM10, U7 small nuclear RNA associated (LSM10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LSM10 (NM_032881) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ969L4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.9 kDa

Amino Acid Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

Validation Images & Assay Conditions

Gene/Protein Information For LSM10 (Source: Uniprot.org, NCBI)

Gene Name

LSM10

Full Name

U7 snRNA-associated Sm-like protein LSm10

Weight

13.9 kDa

Superfamily

snRNP Sm proteins family

Alternative Names

LSM10, U7 small nuclear RNA associated; MGC15749; MST074; MSTP074; U7 snRNA-associated Sm-like protein LSm10; U7 snRNP-specific Sm-like protein LSM10 LSM10 MST074, MSTP074 LSM10, U7 small nuclear RNA associated U7 snRNA-associated Sm-like protein LSm10|U7 snRNP-specific Sm-like protein LSM10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LSM10, check out the LSM10 Infographic

LSM10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LSM10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ969L4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LSM10 (NM_032881) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LSM10 (NM_032881) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LSM10 (NM_032881) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ969L4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.