LINGO4 (NM_001004432) Human Recombinant Protein

LINGO-4 protein,

Recombinant protein of human leucine rich repeat and Ig domain containing 4 (LINGO4)

Product Info Summary

SKU: PROTQ6UY18
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LINGO4 (NM_001004432) Human Recombinant Protein

View all LINGO-4 recombinant proteins

SKU/Catalog Number

PROTQ6UY18

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leucine rich repeat and Ig domain containing 4 (LINGO4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LINGO4 (NM_001004432) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6UY18)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

63.6 kDa

Amino Acid Sequence

MDAATAPKQAWPPWPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPLDTELLDLSGNRLWGLQQGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALARLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRHLDFGMSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF

Validation Images & Assay Conditions

Gene/Protein Information For Lingo4 (Source: Uniprot.org, NCBI)

Gene Name

Lingo4

Full Name

Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4

Weight

63.6 kDa

Alternative Names

leucine rich repeat and Ig domain containing 4; leucine rich repeat neuronal 6D; LINGO4; LINGO-4; LRRN6D; PRO34002

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Lingo4, check out the Lingo4 Infographic

Lingo4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Lingo4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6UY18

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LINGO4 (NM_001004432) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LINGO4 (NM_001004432) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LINGO4 (NM_001004432) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6UY18
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.