LEPROTL1 (NM_015344) Human Recombinant Protein

LEPROTL1 protein,

Purified recombinant protein of Homo sapiens leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1

Product Info Summary

SKU: PROTO95214
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LEPROTL1 (NM_015344) Human Recombinant Protein

View all LEPROTL1 recombinant proteins

SKU/Catalog Number

PROTO95214

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LEPROTL1 (NM_015344) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95214)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.2 kDa

Amino Acid Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW

Validation Images & Assay Conditions

Gene/Protein Information For LEPROTL1 (Source: Uniprot.org, NCBI)

Gene Name

LEPROTL1

Full Name

Leptin receptor overlapping transcript-like 1

Weight

14.2 kDa

Superfamily

OB-RGRP/VPS55 family

Alternative Names

HSPC112; LEPROTL1 leptin receptor overlapping transcript-like 1; my047; Vps55 LEPROTL1 HSPC112, Vps55, my047 leptin receptor overlapping transcript like 1 leptin receptor overlapping transcript-like 1|endospanin-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LEPROTL1, check out the LEPROTL1 Infographic

LEPROTL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LEPROTL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95214

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LEPROTL1 (NM_015344) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LEPROTL1 (NM_015344) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LEPROTL1 (NM_015344) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95214
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.