LASS4 (CERS4) (NM_024552) Human Recombinant Protein

LASS4 protein,

Recombinant protein of human LAG1 homolog, ceramide synthase 4 (LASS4)

Product Info Summary

SKU: PROTQ9HA82
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LASS4 (CERS4) (NM_024552) Human Recombinant Protein

View all LASS4 recombinant proteins

SKU/Catalog Number

PROTQ9HA82

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LAG1 homolog, ceramide synthase 4 (LASS4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LASS4 (CERS4) (NM_024552) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HA82)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.2 kDa

Amino Acid Sequence

MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTAT

Validation Images & Assay Conditions

Gene/Protein Information For CERS4 (Source: Uniprot.org, NCBI)

Gene Name

CERS4

Full Name

Ceramide synthase 4

Weight

46.2 kDa

Alternative Names

CerS4; FLJ12089; LAG1 homolog, ceramide synthase 4; LAG1 longevity assurance homolog 4 (S. cerevisiae); LAG1 longevity assurance homolog 4; Trh1 Cers4|2900019C14Rik, Cer, L, Lass4, Trh, Trh1|ceramide synthase 4|ceramide synthase 4|LAG1 homolog, ceramide synthase 4|LAG1 longevity assurance homolog 4|TRAM homolog 1|longevity assurance homolog 4|sphingosine N-acyltransferase CERS4|translocating chain-associating membrane protein homolog 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CERS4, check out the CERS4 Infographic

CERS4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CERS4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HA82

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LASS4 (CERS4) (NM_024552) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LASS4 (CERS4) (NM_024552) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LASS4 (CERS4) (NM_024552) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HA82
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product