LAGE3 (NM_006014) Human Recombinant Protein

LAGE3 protein,

Product Info Summary

SKU: PROTQ14657
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LAGE3 (NM_006014) Human Recombinant Protein

View all LAGE3 recombinant proteins

SKU/Catalog Number

PROTQ14657

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens L antigen family, member 3 (LAGE3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LAGE3 (NM_006014) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14657)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.6 kDa

Amino Acid Sequence

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR

Validation Images & Assay Conditions

Gene/Protein Information For LAGE3 (Source: Uniprot.org, NCBI)

Gene Name

LAGE3

Full Name

EKC/KEOPS complex subunit LAGE3

Weight

14.6 kDa

Superfamily

CTAG/PCC1 family

Alternative Names

L antigen family, member 3 LAGE3 CVG5, DXS9879E, DXS9951E, ESO3, GAMOS2, ITBA2, Pcc1 L family member 3 EKC/KEOPS complex subunit LAGE3|protein ESO-3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LAGE3, check out the LAGE3 Infographic

LAGE3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LAGE3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14657

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LAGE3 (NM_006014) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LAGE3 (NM_006014) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LAGE3 (NM_006014) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14657
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.