KREMEN1 (NM_001039571) Human Recombinant Protein

Kremen-1 protein,

Recombinant protein of human kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4

Product Info Summary

SKU: PROTQ96MU8
Size: 20 µg
Source: HEK293T

Product Name

KREMEN1 (NM_001039571) Human Recombinant Protein

View all Kremen-1 recombinant proteins

SKU/Catalog Number

PROTQ96MU8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KREMEN1 (NM_001039571) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96MU8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.3 kDa

Amino Acid Sequence

MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD

Validation Images & Assay Conditions

Gene/Protein Information For KREMEN1 (Source: Uniprot.org, NCBI)

Gene Name

KREMEN1

Full Name

Kremen protein 1

Weight

48.3 kDa

Alternative Names

EC 3.4.21; FLJ31863; KREMEM1; kremen protein 1; KREMEN; Kremen1; Kremen-1; kringle containing transmembrane protein 1; kringle containing transmembrane protein; Kringle domain-containing transmembrane protein 1; kringle-coding gene marking the eye and the nose; Kringle-containing protein marking the eye and the nose; KRM1; KRM1Dickkopf receptor KREMEN1 ECTD13, KREMEN, KRM1 kringle containing transmembrane protein 1 kremen protein 1|dickkopf receptor|kringle domain-containing transmembrane protein 1|kringle-coding gene marking the eye and the nose|kringle-containing protein marking the eye and the nose

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KREMEN1, check out the KREMEN1 Infographic

KREMEN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KREMEN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96MU8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KREMEN1 (NM_001039571) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KREMEN1 (NM_001039571) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KREMEN1 (NM_001039571) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96MU8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.