KCTD21 (NM_001029859) Human Recombinant Protein

KCTD21 protein,

Recombinant protein of human potassium channel tetramerisation domain containing 21 (KCTD21)

Product Info Summary

SKU: PROTQ4G0X4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

KCTD21 (NM_001029859) Human Recombinant Protein

View all KCTD21 recombinant proteins

SKU/Catalog Number

PROTQ4G0X4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human potassium channel tetramerisation domain containing 21 (KCTD21)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KCTD21 (NM_001029859) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ4G0X4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.5 kDa

Amino Acid Sequence

MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR

Validation Images & Assay Conditions

Gene/Protein Information For KCTD21 (Source: Uniprot.org, NCBI)

Gene Name

KCTD21

Full Name

BTB/POZ domain-containing protein KCTD21

Weight

29.5 kDa

Alternative Names

BTB/POZ domain-containing protein KCTD21; KCASH2; potassium channel tetramerisation domain containing 21 KCTD21 KCASH2 potassium channel tetramerization domain containing 21 BTB/POZ domain-containing protein KCTD21|potassium channel tetramerisation domain containing 21|potassium channel tetramerization domain-containing protein 21

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KCTD21, check out the KCTD21 Infographic

KCTD21 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCTD21: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ4G0X4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KCTD21 (NM_001029859) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KCTD21 (NM_001029859) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KCTD21 (NM_001029859) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ4G0X4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product