Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein

Kallikrein 8/Neuropsin protein,

Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1

Product Info Summary

SKU: PROTO60259
Size: 20 µg
Source: HEK293T

Product Name

Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein

View all Kallikrein 8/Neuropsin recombinant proteins

SKU/Catalog Number

PROTO60259

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60259)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.9 kDa

Amino Acid Sequence

MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

Validation Images & Assay Conditions

Gene/Protein Information For KLK8 (Source: Uniprot.org, NCBI)

Gene Name

KLK8

Full Name

Kallikrein-8

Weight

27.9 kDa

Superfamily

peptidase S1 family

Alternative Names

EC 3.4.21; EC 3.4.21.118; hK8; HNP; kallikrein 8 (neuropsin/ovasin); Kallikrein 8; kallikrein-related peptidase 8; KLK8 protein type 1; KLK8 protein type 2; KLK8; neuropsin type 1; neuropsin type 2; Neuropsin; NP; NRPN; Ovasin; PRSS19; PRSS19kallikrein-8; Serine protease 19; Serine protease TADG-14; TADG14neuropsin; Tumor-associated differentially expressed gene 14 protein KLK8 HNP, NP, NRPN, PRSS19, TADG14 kallikrein related peptidase 8 kallikrein-8|ovasin|serine protease 19|serine protease TADG-14|tumor-associated differentially expressed gene 14 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KLK8, check out the KLK8 Infographic

KLK8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KLK8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60259

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60259
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.