Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein

IRF9 protein,

Recombinant protein of human interferon regulatory factor 9 (IRF9)

Product Info Summary

SKU: PROTQ00978
Size: 20 µg
Source: HEK293T

Product Name

Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein

View all IRF9 recombinant proteins

SKU/Catalog Number

PROTQ00978

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interferon regulatory factor 9 (IRF9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00978)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.5 kDa

Amino Acid Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Validation Images & Assay Conditions

Gene/Protein Information For IRF9 (Source: Uniprot.org, NCBI)

Gene Name

IRF9

Full Name

Interferon regulatory factor 9

Weight

43.5 kDa

Superfamily

IRF family

Alternative Names

IFN-alpha-responsive transcription factor subunit; interferon regulatory factor 9; Interferon-stimulated gene factor 3 gamma; interferon-stimulated transcription factor 3, gamma (48kD); interferon-stimulated transcription factor 3, gamma 48kDa; IRF9; IRF-9; ISGF3 p48 subunit; ISGF3; ISGF3G; ISGF3GISGF-3 gamma; p48; Transcriptional regulator ISGF3 subunit gamma IRF9 IRF-9, ISGF3, ISGF3G, p48 interferon regulatory factor 9 interferon regulatory factor 9|IFN-alpha-responsive transcription factor subunit|ISGF-3 gamma|ISGF3 p48 subunit|interferon-stimulated gene factor 3 gamma|interferon-stimulated transcription factor 3, gamma (48kD)|interferon-stimulated transcription factor 3, gamma 48kDa|transcriptional regulator ISGF3 subunit gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IRF9, check out the IRF9 Infographic

IRF9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IRF9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Interferon regulatory factor 9 (IRF9) (NM_006084) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00978
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.