Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein

integrin beta 4 binding protein protein,

Recombinant protein of human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2

Product Info Summary

SKU: PROTP56537
Size: 20 µg
Source: HEK293T

Product Name

Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein

View all integrin beta 4 binding protein recombinant proteins

SKU/Catalog Number

PROTP56537

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56537)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.4 kDa

Amino Acid Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Validation Images & Assay Conditions

Gene/Protein Information For EIF6 (Source: Uniprot.org, NCBI)

Gene Name

EIF6

Full Name

Eukaryotic translation initiation factor 6

Weight

26.4 kDa

Superfamily

eIF-6 family

Alternative Names

B(2)GCN homolog; b(2)gcn; B4 integrin interactor; CAB; EIF3Ap27(BBP); eIF-6; eukaryotic translation initiation factor 3A; eukaryotic translation initiation factor 6; ITGB4BPintegrin beta 4 binding protein; p27 beta-4 integrin-binding protein; p27BBP EIF6 CAB, EIF3A, ITGB4BP, b(2)gcn, eIF-6, p27(BBP), p27BBP eukaryotic translation initiation factor 6 eukaryotic translation initiation factor 6|B4 integrin interactor|eukaryotic translation initiation factor 3A|p27 beta-4 integrin-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF6, check out the EIF6 Infographic

EIF6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56537

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Integrin beta 4 binding protein (EIF6) (NM_181468) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56537
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.