Product Info Summary
SKU: | PROTQ8CJ70 |
---|---|
Size: | 2ug, 10ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL-19 Interleukin-19 Mouse Recombinant Protein
View all IL-19 recombinant proteins
SKU/Catalog Number
PROTQ8CJ70
Size
2ug, 10ug, 1mg
Description
Interleukin-19 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL-19 Interleukin-19 Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8CJ70)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL19 (Source: Uniprot.org, NCBI)
Gene Name
IL19
Full Name
Interleukin-19
Weight
Superfamily
IL-10 family
Alternative Names
IL-10C; IL19; IL-19; interleukin 19; MDA1; melanoma differentiation associated protein-like protein; NG.1Melanoma differentiation-associated protein-like protein; ZMDA1interleukin-19 IL19 IL-10C, MDA1, NG.1, ZMDA1 interleukin 19 interleukin-19|melanoma differentiation associated protein-like protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL19, check out the IL19 Infographic
![IL19 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL-19 Interleukin-19 Mouse Recombinant Protein (PROTQ8CJ70)
Hello CJ!
No publications found for PROTQ8CJ70
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL-19 Interleukin-19 Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL-19 Interleukin-19 Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question