IL-19 Interleukin-19 Mouse Recombinant Protein

IL-19 protein, Mouse

Interleukin-19 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ8CJ70
Size: 2ug, 10ug, 1mg
Origin Species: Mouse
Source: Escherichia coli

Product Name

IL-19 Interleukin-19 Mouse Recombinant Protein

View all IL-19 recombinant proteins

SKU/Catalog Number

PROTQ8CJ70

Size

2ug, 10ug, 1mg

Description

Interleukin-19 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IL-19 Interleukin-19 Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8CJ70)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Reconstitution

It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL19 (Source: Uniprot.org, NCBI)

Gene Name

IL19

Full Name

Interleukin-19

Weight

Superfamily

IL-10 family

Alternative Names

IL-10C; IL19; IL-19; interleukin 19; MDA1; melanoma differentiation associated protein-like protein; NG.1Melanoma differentiation-associated protein-like protein; ZMDA1interleukin-19 IL19 IL-10C, MDA1, NG.1, ZMDA1 interleukin 19 interleukin-19|melanoma differentiation associated protein-like protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL19, check out the IL19 Infographic

IL19 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8CJ70

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL-19 Interleukin-19 Mouse Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL-19 Interleukin-19 Mouse Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL-19 Interleukin-19 Mouse Recombinant Protein

Size

Total: $250

SKU:PROTQ8CJ70

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ8CJ70
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.